PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe2G000800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family WOX
Protein Properties Length: 244aa    MW: 26049.1 Da    PI: 8.1086
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe2G000800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox47.14.2e-152686257
                       T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
           Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                       r+R+t+++eq+ +Le+ F++   +p ++e  ++ k l    ++ + +V++WFqNrR + ++
  Aqcoe2G000800.1.p 26 RSRWTPKPEQILILESIFNSgMVNPPKDETVRIRKLLekfgSVGDVNVFYWFQNRRSRSRR 86
                       89*****************99*************************************997 PP

2Wus_type_Homeobox105.92.6e-342588265
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       +r+RWtP+peQi iLe++++sG+++P+k+e+ ri++ Le++G ++d NVfyWFQNr++R+r++q
  Aqcoe2G000800.1.p 25 VRSRWTPKPEQILILESIFNSGMVNPPKDETVRIRKLLEKFGSVGDVNVFYWFQNRRSRSRRRQ 88
                       589***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.13E-142192IPR009057Homeodomain-like
PROSITE profilePS5007111.1592287IPR001356Homeobox domain
SMARTSM003891.2E-52491IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.0E-82690IPR009057Homeodomain-like
PfamPF000468.1E-132686IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048830Biological Processadventitious root development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MEGQDASCPS PSSRPAVGSS AGSPVRSRWT PKPEQILILE SIFNSGMVNP PKDETVRIRK  60
LLEKFGSVGD VNVFYWFQNR RSRSRRRQRQ IQAVGGFASS QHIYPPTSPC VVGTSSSSSS  120
SSSSTSTSAG GGAVNANDLF SISQQMSSPH MDQNSILCPS SDMQLYQSGG SIVTTTTTVF  180
INGIATEVPS GSFDLSAMFG QDHHHHVMLV HSSTGVPVPV NEYGILMQSL QMGESYFLVA  240
GPR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010266735.14e-69PREDICTED: WUSCHEL-related homeobox 11
RefseqXP_010266736.14e-69PREDICTED: WUSCHEL-related homeobox 11
SwissprotQ0D3I71e-59WOX11_ORYSJ; WUSCHEL-related homeobox 11
TrEMBLB9SI527e-68B9SI52_RICCO; Protein WUSCHEL, putative
STRINGPOPTR_0019s05730.12e-65(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03660.11e-34WUSCHEL related homeobox 11